General Information

  • ID:  hor006025
  • Uniprot ID:  Q04618
  • Protein name:  Melanotropin alpha 2
  • Gene name:  pomcb
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  Expressed only in sexually active fish.|Pituitary and hypothalamus of adult diploid animals.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPI
  • Length:  13(112-124)
  • Propeptide:  MFGTFLQNQSVRLNMVCAPWLLAVVVVCVCNPGVEGQCWDSSHCKDLPSEDKILECIHLFRSGLQDESPEPRSAAQQSTEESLSLGILLAALTSGERALDADPEPHSDKRHSYSMEHFRWGKPIGHKRRPIKVYASSLEGGDSSEGTFPLQARRQLSSWEDEMVGALGNQGAKAQTKVVPRTLTVTGLQDKKDGSYRMGHFRWGSPTAIKRYGGFMKPYTQQSHKPLITLLKHVTLKNEQ
  • Signal peptide:  MFGTFLQNQSVRLNMVCAPWLLAVVVVCVCNPGVEG
  • Modification:  T1 N-acetylserine;T13 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; Melanocyte-stimulating hormone alpha: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; Melanocyte-stimulating hormone beta: Incr
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q04618-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006025_AF2.pdbhor006025_ESM.pdb

Physical Information

Mass: 185208 Formula: C76H108N20O19S
Absent amino acids: ACDLNQTV Common amino acids: S
pI: 9.3 Basic residues: 3
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -90 Boman Index: -2536
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 30
Instability Index: 1920.77 Extinction Coefficient cystines: 6990
Absorbance 280nm: 582.5

Literature

  • PubMed ID:  1448114
  • Title:  One of the two trout proopiomelanocortin messenger RNAs potentially encodes new peptides.